PDB entry 5m2e

View 5m2e on RCSB PDB site
Description: Apo structure of Pseudomonas aeruginosa Isocitrate Dehydrogenase, ICD.
Class: oxidoreductase
Keywords: Isocitrate Dehydrogenase, Pseudomonas aeruginosa, Metabolism, oxidoreductase
Deposited on 2016-10-12, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: icd, PA14_30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m2ea_
  • Chain 'B':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: icd, PA14_30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m2eb_
  • Chain 'C':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: icd, PA14_30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m2ec_
  • Chain 'D':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: icd, PA14_30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m2ed_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m2eA (A:)
    mgyqkiqvpatgdkitvnadmslsvpknpiipfiegdgigvdispvmikvvdaavekayk
    gerkiawmevyagekatqvydqdtwlpqetldavrdyvvsikgplttpvgggirslnval
    rqqldlyvcqrpvrwfegvpspvkkpgdvdmvifrensediyagvewkagspeaekvikf
    lteemgvkkirftencgigikpvsqegtkrlvrkalqyavdndrssvtlvhkgnimkfte
    gafkdwgyevardefgaelldggpwmqfknpktgknvvvkdviadamlqqillrpaeydv
    iatlnlngdylsdalaaevggigiapganlsdsvamfeathgtapkyagqdkvnpgslil
    saemmlrhmgwteaadliikgtngaiaaktvtydferlmdgatllscsefgdamiakm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m2eB (B:)
    mgyqkiqvpatgdkitvnadmslsvpknpiipfiegdgigvdispvmikvvdaavekayk
    gerkiawmevyagekatqvydqdtwlpqetldavrdyvvsikgplttpvgggirslnval
    rqqldlyvcqrpvrwfegvpspvkkpgdvdmvifrensediyagvewkagspeaekvikf
    lteemgvkkirftencgigikpvsqegtkrlvrkalqyavdndrssvtlvhkgnimkfte
    gafkdwgyevardefgaelldggpwmqfknpktgknvvvkdviadamlqqillrpaeydv
    iatlnlngdylsdalaaevggigiapganlsdsvamfeathgtapkyagqdkvnpgslil
    saemmlrhmgwteaadliikgtngaiaaktvtydferlmdgatllscsefgdamiakm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m2eC (C:)
    mgyqkiqvpatgdkitvnadmslsvpknpiipfiegdgigvdispvmikvvdaavekayk
    gerkiawmevyagekatqvydqdtwlpqetldavrdyvvsikgplttpvgggirslnval
    rqqldlyvcqrpvrwfegvpspvkkpgdvdmvifrensediyagvewkagspeaekvikf
    lteemgvkkirftencgigikpvsqegtkrlvrkalqyavdndrssvtlvhkgnimkfte
    gafkdwgyevardefgaelldggpwmqfknpktgknvvvkdviadamlqqillrpaeydv
    iatlnlngdylsdalaaevggigiapganlsdsvamfeathgtapkyagqdkvnpgslil
    saemmlrhmgwteaadliikgtngaiaaktvtydferlmdgatllscsefgdamiakm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5m2eD (D:)
    mgyqkiqvpatgdkitvnadmslsvpknpiipfiegdgigvdispvmikvvdaavekayk
    gerkiawmevyagekatqvydqdtwlpqetldavrdyvvsikgplttpvgggirslnval
    rqqldlyvcqrpvrwfegvpspvkkpgdvdmvifrensediyagvewkagspeaekvikf
    lteemgvkkirftencgigikpvsqegtkrlvrkalqyavdndrssvtlvhkgnimkfte
    gafkdwgyevardefgaelldggpwmqfknpktgknvvvkdviadamlqqillrpaeydv
    iatlnlngdylsdalaaevggigiapganlsdsvamfeathgtapkyagqdkvnpgslil
    saemmlrhmgwteaadliikgtngaiaaktvtydferlmdgatllscsefgdamiakm