PDB entry 5m24

View 5m24 on RCSB PDB site
Description: RARg mutant-S371E
Class: nuclear receptor
Keywords: nuclear receptor
Deposited on 2016-10-11, released 2017-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinoic acid receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RARG, NR1B3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13631
      • engineered mutation (197)
    Domains in SCOPe 2.06: d5m24a_
  • Heterogens: 9CR, LMU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m24A (A:)
    gshmdsyelspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfsel
    atkciikivefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdglt
    lnrtqmhnagfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdkl
    qepllealrlyarrrrpeqpymfprmlmkitdlrgistkgaeraitlkmeipgpmpplir
    emlenpemfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m24A (A:)
    lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
    vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
    agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
    rlyarrrrpeqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle