PDB entry 5m1c

View 5m1c on RCSB PDB site
Description: Crystal structure of N-terminally tagged apo-UbiD from E. coli
Class: lyase
Keywords: UbiD, decarboxylase, ubiquinone biosynthesis, prFMN binding, lyase
Deposited on 2016-10-07, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: ubiD, c4790
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m1ca1, d5m1ca2
  • Chain 'B':
    Compound: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: ubiD, c4790
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m1cb1, d5m1cb2
  • Chain 'C':
    Compound: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: ubiD, c4790
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m1cc1, d5m1cc2
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m1cA (A:)
    mgsshhhhhhssglvprgshmdamkyndlrdfltlleqqgelkritlpvdphleiteiad
    rtlraggpallfenpkgysmpvlcnlfgtpkrvamgmgqedvsalrevgkllaflkepep
    pkgfrdlfdklpqfkqvlnmptkrlrgapcqqkivsgddvdlnripimtcwpedaaplit
    wgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaahpgerfpvsva
    lgadpatilgavtpvpdtlseyafagllrgtktevvkcisndlevpasaeivlegyieqg
    etapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrppdepavlgvalnevf
    vpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgvwsflrqfmytkfviv
    cdddvnardwndviwaittrmdpardtvlventpidyldfaspvsglgskmgldatnkwp
    getqrewgrpikkdpdvvahidaiwdelaifnngksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m1cA (A:)
    dlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnlf
    gtpkrvamgmgqedvsalrevgkptkrlrgapcqqkivsgddvdlnripimtcwpedaap
    litwgltvtrqnlgiyrqqligknklimrwlshrggaldyqewcaahpgerfpvsvalga
    dpatilgavtagllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgy
    ynevdsfpvftvthitqredaiyhstytgrppdepavlgvalnevfvpilqkqfpeivdf
    ylppegcsyrlavvtikkqyaghakrvmmgvwsflrqfmytkfvivcdddvnardwndvi
    waittrmdpardtvlventpidyldfaspvsglgskmgldatnkwpgetqrewgrpikkd
    pdvvahidaiwdelaif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m1cB (B:)
    mgsshhhhhhssglvprgshmdamkyndlrdfltlleqqgelkritlpvdphleiteiad
    rtlraggpallfenpkgysmpvlcnlfgtpkrvamgmgqedvsalrevgkllaflkepep
    pkgfrdlfdklpqfkqvlnmptkrlrgapcqqkivsgddvdlnripimtcwpedaaplit
    wgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaahpgerfpvsva
    lgadpatilgavtpvpdtlseyafagllrgtktevvkcisndlevpasaeivlegyieqg
    etapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrppdepavlgvalnevf
    vpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgvwsflrqfmytkfviv
    cdddvnardwndviwaittrmdpardtvlventpidyldfaspvsglgskmgldatnkwp
    getqrewgrpikkdpdvvahidaiwdelaifnngksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m1cB (B:)
    ndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnl
    fgtpkrvamgmgqedvsalrevgkllaflkptkrlrgapcqqkivsgddvdlnripimtc
    wpedaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaah
    pgerfpvsvalgadpatilgavtpvpdtlseyafagllrgtktevvkcisndlevpasae
    ivlegyieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrppdepa
    vlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgvwsflr
    qfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvsglgsk
    mgldatnkwpgetqrewgrpikkdpdvvahidaiwdelai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5m1cC (C:)
    mgsshhhhhhssglvprgshmdamkyndlrdfltlleqqgelkritlpvdphleiteiad
    rtlraggpallfenpkgysmpvlcnlfgtpkrvamgmgqedvsalrevgkllaflkepep
    pkgfrdlfdklpqfkqvlnmptkrlrgapcqqkivsgddvdlnripimtcwpedaaplit
    wgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaahpgerfpvsva
    lgadpatilgavtpvpdtlseyafagllrgtktevvkcisndlevpasaeivlegyieqg
    etapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrppdepavlgvalnevf
    vpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgvwsflrqfmytkfviv
    cdddvnardwndviwaittrmdpardtvlventpidyldfaspvsglgskmgldatnkwp
    getqrewgrpikkdpdvvahidaiwdelaifnngksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m1cC (C:)
    ndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnl
    fgtpkrvamgmgqedvsalrevgkllaflgapcqqkivsgddvdlnripimtcwpedaap
    litwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaahpgerfpv
    svalgadpatilgavtpvyafagllrgtktevvkcisndlevpasaeivlegyieqgeta
    pegpygdhtgyynevdsfpvftvthitqredaiyhstytgrppdepavlgvalnevfvpi
    lqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgvwsflrqfmytkfvivcdd
    dvnardwndviwaittrmdpardtvlventpidyldfaspvsglgskmgldatnkwpget
    qrewgrpikkdpdvvahidaiwdelaif