PDB entry 5m1b

View 5m1b on RCSB PDB site
Description: Crystal structure of C-terminally tagged apo-UbiD from E. coli
Class: lyase
Keywords: UbiD, decarboxylase, ubiquinone biosynthesis, prFMN binding, Lyase
Deposited on 2016-10-07, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: ubiD, c4790
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m1ba1, d5m1ba2
  • Chain 'B':
    Compound: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: ubiD, c4790
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m1bb1, d5m1bb2
  • Chain 'C':
    Compound: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: ubiD, c4790
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5m1bc1, d5m1bc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m1bA (A:)
    mdamkyndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysm
    pvlcnlfgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnm
    ptkrlrgapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyr
    qqligknklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtls
    eyafagllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevds
    fpvftvthitqredaiyhstytgrppdepavlgvalnevfvpilqkqfpeivdfylppeg
    csyrlavvtikkqyaghakrvmmgvwsflrqfmytkfvivcdddvnardwndviwaittr
    mdpardtvlventpidyldfaspvsglgskmgldatnkwpgetqrewgrpikkdpdvvah
    idaiwdelaifnngksalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m1bA (A:)
    dlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnlf
    gtpkrvamgmgqedvsalrevgkllaptkrlrgapcqqkivsgddvdlnripimtcwped
    aaplitwgltvtrqnlgiyrqqligknklimrwlshrggaldyqewcaahpgerfpvsva
    lgadpatilgavtagllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdh
    tgyynevdsfpvftvthitqredaiyhstytgrppdepavlgvalnevfvpilqkqfpei
    vdfylppegcsyrlavvtikkqyaghakrvmmgvwsflrqfmytkfvivcdddvnardwn
    dviwaittrmdpardtvlventpidyldfaspvsglgskmgldatnkwpgetqrewgrpi
    kkdpdvvahidaiwdelaif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m1bB (B:)
    mdamkyndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysm
    pvlcnlfgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnm
    ptkrlrgapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyr
    qqligknklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtls
    eyafagllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevds
    fpvftvthitqredaiyhstytgrppdepavlgvalnevfvpilqkqfpeivdfylppeg
    csyrlavvtikkqyaghakrvmmgvwsflrqfmytkfvivcdddvnardwndviwaittr
    mdpardtvlventpidyldfaspvsglgskmgldatnkwpgetqrewgrpikkdpdvvah
    idaiwdelaifnngksalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m1bB (B:)
    yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn
    lfgtpkrvamgmgqedvsalrevgkllaflkptkrlrgapcqqkivsgddvdlnripimt
    cwpedaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaa
    hpgerfpvsvalgadpatilgavtpvpdtlseyafagllrgtktevvkcisndlevpasa
    eivlegyieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrppdep
    avlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgvwsfl
    rqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvsglgs
    kmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5m1bC (C:)
    mdamkyndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysm
    pvlcnlfgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnm
    ptkrlrgapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyr
    qqligknklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtls
    eyafagllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevds
    fpvftvthitqredaiyhstytgrppdepavlgvalnevfvpilqkqfpeivdfylppeg
    csyrlavvtikkqyaghakrvmmgvwsflrqfmytkfvivcdddvnardwndviwaittr
    mdpardtvlventpidyldfaspvsglgskmgldatnkwpgetqrewgrpikkdpdvvah
    idaiwdelaifnngksalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m1bC (C:)
    ndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnl
    fgtpkrvamgmgqedvsalrevgkllaflgapcqqkivsgddvdlnripimtcwpedaap
    litwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaahpgerfpv
    svalgadpatilgavtpvyafagllrgtktevvkcisndlevpasaeivlegyieqgeta
    pegpygdhtgyynevdsfpvftvthitqredaiyhstytgrppdepavlgvalnevfvpi
    lqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgvwsflrqfmytkfvivcdd
    dvnardwndviwaittrmdpardtvlventpidyldfaspvsglgskmgldatnkwpget
    qrewgrpikkdpdvvahidaiwdelaif