PDB entry 5m16

View 5m16 on RCSB PDB site
Description: Structure of GH36 alpha-galactosidase from Thermotoga maritima in complex with a hydrolysed cyclopropyl carbasugar.
Class: hydrolase
Keywords: Alpha-galactosidase, glycoside hydrolase, hydrolase
Deposited on 2016-10-07, released 2016-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-galactosidase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: galA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33835 (23-End)
      • expression tag (15-22)
    Domains in SCOPe 2.06: d5m16a1, d5m16a2, d5m16a3
  • Heterogens: SO4, MG, 7D2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m16A (A:)
    mgsshhhhhhssglvprgshmasmeifgktfregrfvlkeknftvefavekihlgwkisg
    rvkgspgrlevlrtkapekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvle
    rnlqsdyfvaeegkvygflsskiahpffavedgelvayleyfdvefddfvpleplvvled
    pntplllekyaelvgmennarvpkhtptgwcswyhyfldltweetlknlklaknfpfevf
    qiddayekdigdwlvtrgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwv
    vkengepkmayrnwnkkiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpge
    rkknitpiqafrkgietirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehie
    dngapaarwalrnaitryfmhdrfwlndpdclilreektdltqkekelysytcgvldnmi
    iesddlslvrdhgkkvlketlellggrprvqnimsedlryeivssgtlsgnvkivvdlns
    reyhlekegksslkkrvvkredgrnfyfyeegere
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m16A (A:)
    prgshmasmeifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtk
    apekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkv
    ygflsskiahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvg
    mennarvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwlv
    trgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnwn
    kkiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkgi
    etirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnai
    tryfmhdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkk
    vlketlellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke