PDB entry 5m12

View 5m12 on RCSB PDB site
Description: Structure of GH36 alpha-galactosidase from Thermotoga maritima in complex with intact cyclopropyl-carbasugar.
Class: hydrolase
Keywords: Alpha-galactosidase, glycoside hydrolase, hydrolase
Deposited on 2016-10-07, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-galactosidase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: galA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33835 (23-End)
      • expression tag (14-22)
    Domains in SCOPe 2.07: d5m12a1, d5m12a2, d5m12a3
  • Heterogens: SO4, MG, 7D0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m12A (A:)
    mgsshhhhhhssglvprgshmasmeifgktfregrfvlkeknftvefavekihlgwkisg
    rvkgspgrlevlrtkapekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvle
    rnlqsdyfvaeegkvygflsskiahpffavedgelvayleyfdvefddfvpleplvvled
    pntplllekyaelvgmennarvpkhtptgwcswyhyfldltweetlknlklaknfpfevf
    qiddayekdigdwlvtrgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwv
    vkengepkmayrnwnkkiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpge
    rkknitpiqafrkgietirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehie
    dngapaarwalrnaitryfmhdrfwlndpdclilreektdltqkekelysytcgvldnmi
    iesddlslvrdhgkkvlketlellggrprvqnimsedlryeivssgtlsgnvkivvdlns
    reyhlekegksslkkrvvkredgrnfyfyeegere
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m12A (A:)
    vprgshmasmeifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrt
    kapekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegk
    vygflsskiahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelv
    gmennarvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwl
    vtrgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnw
    nkkiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkg
    ietirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrna
    itryfmhdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgk
    kvlketlellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke