PDB entry 5lxy

View 5lxy on RCSB PDB site
Description: Structure of the minimal RBM7 - ZCCHC8 Complex
Class: RNA binding protein
Keywords: NEXT Complex RRM RBM7 ZCCHC8, RNA Binding Protein
Deposited on 2016-09-23, released 2016-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lxya_
  • Chain 'B':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lxyb_
  • Chain 'C':
    Compound: Zinc finger CCHC domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ZCCHC8
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Zinc finger CCHC domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ZCCHC8
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lxye_
  • Chain 'F':
    Compound: Zinc finger CCHC domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ZCCHC8
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lxyg_
  • Chain 'H':
    Compound: Zinc finger CCHC domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ZCCHC8
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lxyi_
  • Chain 'J':
    Compound: Zinc finger CCHC domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ZCCHC8
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lxyk_
  • Chain 'L':
    Compound: Zinc finger CCHC domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ZCCHC8
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lxym_
  • Chain 'N':
    Compound: Zinc finger CCHC domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ZCCHC8
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lxyA (A:)
    gpdsmgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvn
    fkhevsvpyamnllngiklygrpikiqfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxyA (A:)
    eadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpya
    mnllngiklygrpikiqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lxyB (B:)
    gpdsmgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvn
    fkhevsvpyamnllngiklygrpikiqfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxyB (B:)
    aeadrtlfvgnletkvteellfelfhqagpvikvkipkpkqfafvnfkhevsvpyamnll
    ngiklygrpikiqfrs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5lxyE (E:)
    gpdsmgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvn
    fkhevsvpyamnllngiklygrpikiqfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxyE (E:)
    aeadrtlfvgnletkvteellfelfhqagpvikvkipqfafvnfkhevsvpyamnllngi
    klygrpikiqfrs
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5lxyG (G:)
    gpdsmgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvn
    fkhevsvpyamnllngiklygrpikiqfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxyG (G:)
    eadrtlfvgnletkvteellfelfhqagpvikvkipqfafvnfkhevsvpyamnllngik
    lygrpikiqfrs
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5lxyI (I:)
    gpdsmgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvn
    fkhevsvpyamnllngiklygrpikiqfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxyI (I:)
    eadrtfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpyam
    nllngiklygrpikiqfrs
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5lxyK (K:)
    gpdsmgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvn
    fkhevsvpyamnllngiklygrpikiqfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxyK (K:)
    drtlfvgnletkvteellfelfhqagpvikvkkpkqfafvnfkhevsvpyamnllngikl
    ygrpikiqfrs
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5lxyM (M:)
    gpdsmgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvn
    fkhevsvpyamnllngiklygrpikiqfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxyM (M:)
    eadrtlfvgnltkvtellfelfhqagpvikvqfafvnfkhevsvpyamnllngiklypik
    iqfr
    

  • Chain 'N':
    No sequence available.