PDB entry 5lxr

View 5lxr on RCSB PDB site
Description: Structure of the minimal RBM7 - ZCCHC8 Complex
Class: RNA binding protein
Keywords: NEXT Complex RRM RBM7 ZCCHC8, RNA Binding Protein
Deposited on 2016-09-22, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lxra_
  • Chain 'B':
    Compound: Zinc finger CCHC domain-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: ZCCHC8
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SM, BR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lxrA (A:)
    gpdsmgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvn
    fkhevsvpyamnllngiklygrpikiqfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lxrA (A:)
    eadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpya
    mnllngiklygrpikiqfrs
    

  • Chain 'B':
    No sequence available.