PDB entry 5lxg

View 5lxg on RCSB PDB site
Description: Revised crystal structure of the human adiponectin receptor 1 in an open conformation
Class: membrane protein
Keywords: progestin and adipoq receptor family, integral membrane protein, 7tm, ceramidase, membrane protein
Deposited on 2016-09-21, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adiponectin receptor protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ADIPOR1, PAQR1, TESBP1A, CGI-45
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96A54 (18-End)
      • expression tag (16-17)
  • Chain 'H':
    Compound: V region heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LXG (0-118)
    Domains in SCOPe 2.07: d5lxgh_
  • Chain 'L':
    Compound: V region light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LXG (0-106)
    Domains in SCOPe 2.07: d5lxgl_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lxgH (H:)
    evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
    nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lxgL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein