PDB entry 5lwl

View 5lwl on RCSB PDB site
Description: MaeR D54A mutant response regulator bound to sulfate
Class: transcription
Keywords: Response regulator Beryllium trifluoride Catalytic aspartic acid, Transcription
Deposited on 2016-09-18, released 2017-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcriptional regulatory protein
  Species: Lactobacillus paracasei [TaxId:1597]
  Gene: LPL9_2999
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0K1MY03 (2-121)
    • expression tag (0-1)
    • engineered mutation (54)
  Domains in SCOPe 2.06: d5lwla1, d5lwla2
• Chain 'B':
  Compound: transcriptional regulatory protein
  Species: Lactobacillus paracasei [TaxId:1597]
  Gene: LPL9_2999
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0K1MY03 (2-121)
    • expression tag (0-1)
    • engineered mutation (54)
  Domains in SCOPe 2.06: d5lwlb1, d5lwlb2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lwlA (A:)
  aatniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvllairlkd
  gngidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryr
  tk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lwlB (B:)
  aatniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvllairlkd
  gngidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryr
  tk