PDB entry 5lwf

View 5lwf on RCSB PDB site
Description: Structure of a single domain camelid antibody fragment cAb-G10S in complex with the BlaP beta-lactamase from Bacillus licheniformis
Class: hydrolase
Keywords: hydrolase, vhh, aggregation
Deposited on 2016-09-16, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: penP, blaP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00808
      • insertion (167)
      • insertion (167)
    Domains in SCOPe 2.07: d5lwfa_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: penP, blaP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00808
      • insertion (167)
      • insertion (167)
    Domains in SCOPe 2.07: d5lwfb_
  • Chain 'C':
    Compound: Camelid heavy-chain antibody variable fragment cAb-G10S
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LWF
    Domains in SCOPe 2.07: d5lwfc1, d5lwfc2
  • Chain 'D':
    Compound: Camelid heavy-chain antibody variable fragment cAb-G10S
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LWF
    Domains in SCOPe 2.07: d5lwfd1, d5lwfd2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lwfA (A:)
    temkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksie
    dlnqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslk
    kelrkigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrell
    idwmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdk
    kdakyddkliaeatkvvmkalnmngkgphhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lwfA (A:)
    kddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedln
    qritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkel
    rkigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrellidw
    mkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkda
    kyddkliaeatkvvmkaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lwfB (B:)
    temkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksie
    dlnqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslk
    kelrkigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrell
    idwmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdk
    kdakyddkliaeatkvvmkalnmngkgphhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lwfB (B:)
    ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
    ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
    kigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrellidwm
    krnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdak
    yddkliaeatkvvmkaln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lwfC (C:)
    qvqlqesggglvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyy
    adsvkgrfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lwfC (C:)
    vqlqesggglvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyya
    dsvkgrfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqv
    tv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lwfD (D:)
    qvqlqesggglvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyy
    adsvkgrfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lwfD (D:)
    qlqesgvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvk
    grfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv