PDB entry 5lve

View 5lve on RCSB PDB site
Description: structure of the variable domain of human immunoglobulin k-4 light chain len
Class: immune system
Keywords: immunoglobulin, bence-jones protein, immune system
Deposited on 1999-02-24, released 2000-02-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bence-jones protein len
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01625 (0-113)
    • engineered mutation (94)
  Domains in SCOPe 2.05: d5lvea_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lveA (A:)
  divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
  esgvpdrfsgsgsgtdftltisslqaedvavyycaqyystpysfgqgtkleikr