PDB entry 5lve

View 5lve on RCSB PDB site
Description: structure of the variable domain of human immunoglobulin k-4 light chain len
Deposited on 1999-02-24, released 2000-02-18
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d5lvea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lveA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycaqyystpysfgqgtkleikr