PDB entry 5ltq

View 5ltq on RCSB PDB site
Description: Structure of the Yellow Fluorescent Protein lanYFP from Branchiostoma lanceolatum at pH 7.5
Class: fluorescent protein
Keywords: fluorescent protein
Deposited on 2016-09-07, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (44-261)
      • expression tag (42-43)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqa1, d5ltqa2
  • Chain 'B':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (44-261)
      • expression tag (43)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqb1, d5ltqb2
  • Chain 'C':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (44-261)
      • expression tag (43)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqc1, d5ltqc2
  • Chain 'D':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (44-261)
      • expression tag (41-43)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqd1, d5ltqd2
  • Chain 'E':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (Start-261)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqe_
  • Chain 'F':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (Start-261)
      • chromophore (101)
      • variant (213)
      • variant (216)
      • expression tag (262-268)
    Domains in SCOPe 2.06: d5ltqf1, d5ltqf2
  • Chain 'G':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (44-261)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqg_
  • Chain 'H':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (Start-261)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqh_
  • Chain 'I':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (Start-261)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqi_
  • Chain 'J':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (44-261)
      • chromophore (101)
      • variant (213)
      • variant (216)
      • expression tag (262-267)
    Domains in SCOPe 2.06: d5ltqj1, d5ltqj2
  • Chain 'K':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (Start-261)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqk_
  • Chain 'L':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (44-261)
      • expression tag (43)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltql1, d5ltql2
  • Chain 'M':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqm_
  • Chain 'N':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (Start-261)
      • chromophore (101)
      • variant (213)
      • variant (216)
      • expression tag (262-264)
    Domains in SCOPe 2.06: d5ltqn1, d5ltqn2
  • Chain 'O':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqo_
  • Chain 'P':
    Compound: Green fluorescent protein blFP-Y3
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PNC0 (44-261)
      • expression tag (43)
      • chromophore (101)
      • variant (213)
      • variant (216)
    Domains in SCOPe 2.06: d5ltqp1, d5ltqp2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ltqA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqA (A:)
    maslpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigy
    gfhqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvig
    tgfpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfak
    pmaanilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ltqB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqB (B:)
    aslpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigyg
    fhqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigt
    gfpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakp
    maanilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ltqC (C:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqC (C:)
    aslpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigyg
    fhqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigt
    gfpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakp
    maanilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ltqD (D:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqD (D:)
    nmaslpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqig
    ygfhqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvi
    gtgfpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfa
    kpmaanilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ltqE (E:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqE (E:)
    lpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfh
    qylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgf
    padgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpma
    anilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ltqF (F:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqF (F:)
    lpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfh
    qylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgf
    padgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpma
    anilknqpmfvfrktelkhsktelnfkewqkaftdvmgmdelyk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ltqG (G:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqG (G:)
    slpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygf
    hqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtg
    fpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpm
    aanilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ltqH (H:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqH (H:)
    lpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfh
    qylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgf
    padgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpma
    anilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5ltqI (I:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqI (I:)
    lpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfh
    qylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgf
    padgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpma
    anilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5ltqJ (J:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqJ (J:)
    slpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygf
    hqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtg
    fpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpm
    aanilknqpmfvfrktelkhsktelnfkewqkaftdvmgmdely
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5ltqK (K:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqK (K:)
    lpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfh
    qylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgf
    padgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpma
    anilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ltqL (L:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqL (L:)
    aslpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigyg
    fhqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigt
    gfpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakp
    maanilknqpmfvfrktelkhsktelnfkewqkaftdvm
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5ltqM (M:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqM (M:)
    pathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhq
    ylpfmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadg
    pvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanil
    knqpmfvfrktelkhsktelnfkewqkaft
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5ltqN (N:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqN (N:)
    pathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhq
    ylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfp
    adgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaa
    nilknqpmfvfrktelkhsktelnfkewqkaftdvmgmd
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5ltqO (O:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqO (O:)
    pathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhq
    ylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfp
    adgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaa
    nilknqpmfvfrktelkhsktelnfkewqkaft
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5ltqP (P:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
    vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
    mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
    wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
    elkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltqP (P:)
    aslpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigyg
    fhqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigt
    gfpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakp
    maanilknqpmfvfrktelkhsktelnfkewqkaftdvm