PDB entry 5lsl

View 5lsl on RCSB PDB site
Description: Crystal structure of yeast Hsh49p in complex with Cus1p binding domain.
Class: RNA binding domain
Keywords: Splicing, U2 snRNP, SF3b complex, RNA binding domain
Deposited on 2016-09-02, released 2017-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein HSH49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSH49, YOR319W, O6142
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lsla_
  • Chain 'B':
    Compound: Protein HSH49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSH49, YOR319W, O6142
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lslb_
  • Chain 'C':
    Compound: Protein HSH49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSH49, YOR319W, O6142
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lslc_
  • Chain 'D':
    Compound: Protein HSH49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HSH49, YOR319W, O6142
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5lsld_
  • Chain 'E':
    Compound: Cold sensitive U2 snRNA suppressor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CUS1, YMR240C, YM9408.02C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02554 (5-End)
      • expression tag (4)
  • Chain 'F':
    Compound: Cold sensitive U2 snRNA suppressor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CUS1, YMR240C, YM9408.02C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02554 (5-End)
      • expression tag (3-4)
  • Chain 'G':
    Compound: Cold sensitive U2 snRNA suppressor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CUS1, YMR240C, YM9408.02C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02554 (5-End)
      • expression tag (4)
  • Chain 'H':
    Compound: Cold sensitive U2 snRNA suppressor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CUS1, YMR240C, YM9408.02C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02554 (5-End)
      • expression tag (4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5lslA (A:)
ggsnysadsgntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefy
nqgdaqyaikimnntvrlydrlikvrqvtnstgttnlpsnis

    Sequence, based on observed residues (ATOM records): (download) 
    >5lslA (A:)
gntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefynqgdaqyai
kimnntvrlydrlikvrqv

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5lslB (B:)
ggsnysadsgntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefy
nqgdaqyaikimnntvrlydrlikvrqvtnstgttnlpsnis

    Sequence, based on observed residues (ATOM records): (download) 
    >5lslB (B:)
gntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefynqgdaqyai
kimnntvrlydrlikvrqv

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >5lslC (C:)
ggsnysadsgntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefy
nqgdaqyaikimnntvrlydrlikvrqvtnstgttnlpsnis

    Sequence, based on observed residues (ATOM records): (download) 
    >5lslC (C:)
gntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefynqgdaqyai
kimnntvrlydrlikvrqv

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >5lslD (D:)
ggsnysadsgntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefy
nqgdaqyaikimnntvrlydrlikvrqvtnstgttnlpsnis

    Sequence, based on observed residues (ATOM records): (download) 
    >5lslD (D:)
gntvyvgnidpritkeqlyelfiqinpvlrikypkdkvlqayqgyafiefynqgdaqyai
kimnntvrlydrlikvrqv

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.