PDB entry 5lsa

View 5lsa on RCSB PDB site
Description: human catechol O-methyltransferase in complex with SAM and DNC at 1.50A
Class: transferase
Keywords: methyltransferase, neurotransmitter degradation, transferase
Deposited on 2016-08-24, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lsaa_
  • Heterogens: MG, CL, SAM, DNC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lsaA (A:)
    mgdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqps
    vllelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasq
    diipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfl
    ahvrgsscfecthyqsfleyrevvdglekaiykgpgseagp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lsaA (A:)
    dtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsvl
    lelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqdi
    ipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdflah
    vrgsscfecthyqsfleyrevvdglekaiykgpg