PDB entry 5lr0

View 5lr0 on RCSB PDB site
Description: Binding domain of Botulinum Neurotoxin DC in complex with SialylT
Class: hydrolase
Keywords: botulnimun neurotoxin, carbohydrate binding, hydrolase
Deposited on 2016-08-18, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin D/C protein
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont, boNT D, C, DC, NT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lr0a1, d5lr0a2
  • Chain 'B':
    Compound: Botulinum neurotoxin D/C protein
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont, boNT D, C, DC, NT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lr0b1, d5lr0b2
  • Heterogens: SIA, GAL, NGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lr0A (A:)
    mhhhhhhyfsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgdd
    rgkvivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnfl
    vftlkqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkel
    tginfsktitfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqytnv
    vkdywgndlrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgnt
    ndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqp
    cntfdyyasqlflssnattnrlgilsigsysfklgddywfnheylipvikiehyaslles
    tsthwvfvpas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lr0A (A:)
    indskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqne
    ynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnenseqd
    infsydisknaagynkwffvtittnmmgnmmiyingklidtikvkelinfsktitfqmnk
    ipdninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydkeyyminvnymn
    rymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyfnttidnkqysl
    gmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlflssnattnrlgi
    lsigsysfklgddywfnheylipvikiehyaslleststhwvfvpas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lr0B (B:)
    mhhhhhhyfsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgdd
    rgkvivtqnenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnfl
    vftlkqnenseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkel
    tginfsktitfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqytnv
    vkdywgndlrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgnt
    ndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqp
    cntfdyyasqlflssnattnrlgilsigsysfklgddywfnheylipvikiehyaslles
    tsthwvfvpas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lr0B (B:)
    sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
    enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
    seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
    tfqmnkidninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydkeyymin
    vnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyfnttidn
    kqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlflssnatt
    nrlgilsigsysfklgddywfnheylipvikiehyaslleststhwvfvpas