PDB entry 5lqf

View 5lqf on RCSB PDB site
Description: CDK1/CyclinB1/CKS2 in complex with NU6102
Class: transferase
Keywords: CDK1 CYCLIN B CKS2 CELL CYCLE NU6102, transferase
Deposited on 2016-08-17, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-dependent kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK1, CDC2, CDC28A, CDKN1, P34CDC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06493 (5-End)
      • expression tag (2-4)
    Domains in SCOPe 2.06: d5lqfa1, d5lqfa2
  • Chain 'B':
    Compound: g2/mitotic-specific cyclin-b1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNB1, CCNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14635
      • conflict (6)
      • conflict (77)
      • conflict (189)
  • Chain 'C':
    Compound: Cyclin-dependent kinases regulatory subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CKS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lqfc_
  • Chain 'D':
    Compound: Cyclin-dependent kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK1, CDC2, CDC28A, CDKN1, P34CDC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06493 (5-End)
      • expression tag (2-4)
    Domains in SCOPe 2.06: d5lqfd1, d5lqfd2
  • Chain 'E':
    Compound: g2/mitotic-specific cyclin-b1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNB1, CCNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14635
      • conflict (6)
      • conflict (77)
      • conflict (189)
  • Chain 'F':
    Compound: Cyclin-dependent kinases regulatory subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CKS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lqff_
  • Heterogens: 4SP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lqfA (A:)
    gplgsmedytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisll
    kelrhpnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqg
    ivfchsrrvlhrdlkpqnlliddkgtikladfglarafgipirvythevvtlwyrspevl
    lgsarystpvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslq
    dykntfpkwkpgslashvknldengldllskmliydpakrisgkmalnhpyfndldnqik
    km
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lqfA (A:)
    lgsmedytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisllke
    lrhpnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqgiv
    fchsrrvlhrdlkpqnlliddkgtikladfglarafgipirvvtlwyrspevllgsarys
    tpvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslqdykntfp
    kwkpgslashvknldengldllskmliydpakrisgkmalnhpyfnd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lqfC (C:)
    gplgsmahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwv
    hymihepephillfrrplpkdqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lqfC (C:)
    mahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymih
    epephillfrrplp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lqfD (D:)
    gplgsmedytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisll
    kelrhpnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqg
    ivfchsrrvlhrdlkpqnlliddkgtikladfglarafgipirvythevvtlwyrspevl
    lgsarystpvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslq
    dykntfpkwkpgslashvknldengldllskmliydpakrisgkmalnhpyfndldnqik
    km
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lqfD (D:)
    lgsmedytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisllke
    lrhpnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqgiv
    fchsrrvlhrdlkpqnlliddkgtikladfglarafgipirtlwyrspevllgsarystp
    vdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslqdykntfpkw
    kpgslashvknldengldllskmliydpakrisgkmalnhpyfnd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5lqfF (F:)
    gplgsmahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwv
    hymihepephillfrrplpkdqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lqfF (F:)
    mahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymih
    epephillfrrplp