PDB entry 5lqc

View 5lqc on RCSB PDB site
Description: Crystal Structure of COMT in complex with N-[(E)-3-[(2R,3S,4R,5R)-3,4-dihydroxy-5-[6-(methylamino)purin-9-yl]oxolan-2-yl]prop-2-enyl]-5-(4-fluorophenyl)-2,3-dihydroxybenzamide
Class: transferase
Keywords: methyltransferase, neurotransmitter degradation, transferase
Deposited on 2016-08-16, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lqca_
  • Heterogens: 542, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lqcA (A:)
    mgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireysps
    lvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasq
    dlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfl
    ayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lqcA (A:)
    tkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslvl
    elgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdli
    pqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflayv
    rgsssfecthyssyleymkvvdglekaiyqgps