PDB entry 5lqa

View 5lqa on RCSB PDB site
Description: rat catechol O-methyltransferase at high pH in complex with a bisubstrate inhibitor
Class: transferase
Keywords: methyltransferase, neurotransmitter degradation, transferase
Deposited on 2016-08-16, released 2016-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lqaa_
  • Heterogens: NHE, 619, SO4, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lqaA (A:)
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp