PDB entry 5lp7

View 5lp7 on RCSB PDB site
Description: Crystal structure of 3-Ketoacyl-CoA Thiolase (MmgA) from Bacillus subtilis.
Class: transferase
Keywords: Thiolase, transferase
Deposited on 2016-08-11, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA acetyltransferase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgA, yqiL, BSU24170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lp7a1, d5lp7a2
  • Chain 'B':
    Compound: Acetyl-CoA acetyltransferase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgA, yqiL, BSU24170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lp7b1, d5lp7b2
  • Chain 'C':
    Compound: Acetyl-CoA acetyltransferase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgA, yqiL, BSU24170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lp7c1, d5lp7c2
  • Chain 'D':
    Compound: Acetyl-CoA acetyltransferase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgA, yqiL, BSU24170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lp7d1, d5lp7d2
  • Chain 'E':
    Compound: Acetyl-CoA acetyltransferase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgA, yqiL, BSU24170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lp7e1, d5lp7e2
  • Chain 'F':
    Compound: Acetyl-CoA acetyltransferase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgA, yqiL, BSU24170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lp7f1, d5lp7f2
  • Chain 'G':
    Compound: Acetyl-CoA acetyltransferase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgA, yqiL, BSU24170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lp7g1, d5lp7g2
  • Chain 'H':
    Compound: Acetyl-CoA acetyltransferase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgA, yqiL, BSU24170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lp7h1, d5lp7h2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lp7A (A:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdg
    sitagnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkl
    lkkngltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilm
    tlvyelkrrggglgvaaicsgaaqgdavlvqvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lp7A (A:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwinvvdkdeairrdtsldqlaklapiyasdgsitagn
    apgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkllkkngl
    tvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilmtlvyel
    krrggglgvaaicsgaqgdavlvqvh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lp7B (B:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdg
    sitagnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkl
    lkkngltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilm
    tlvyelkrrggglgvaaicsgaaqgdavlvqvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lp7B (B:)
    rktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqags
    gqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsni
    pyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalr
    sharaakaadegkfqdeivpvnwigkpnvvdkdeairrdtsldqlaklapiysdgsitag
    napgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkllkkng
    ltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilmtlvye
    lkrrggglgvaaicsgaaqgdavlvqvh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lp7C (C:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdg
    sitagnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkl
    lkkngltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilm
    tlvyelkrrggglgvaaicsgaaqgdavlvqvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lp7C (C:)
    rktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqags
    gqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsni
    pyapagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalrs
    haraakaadegkfqdeivpvnwigkpnvvdkdeairrdtslqlaklapiyasdgsitagn
    apgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkllkkngl
    tvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilmtlvyel
    krrggglgvaaicsgaaqgdavlvqvh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lp7D (D:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdg
    sitagnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkl
    lkkngltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilm
    tlvyelkrrggglgvaaicsgaaqgdavlvqvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lp7D (D:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkcasglravtlcdqmiraqdadilvaggmesmsni
    pyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalr
    sharaakaadegkfqdeivpvnwignvvdkdeairrdtsldqlaklapiyasgsitagna
    pgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkllkknglt
    vqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilmtlvyelk
    rrggglgvaaicsgaaqgdavlvqvh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5lp7E (E:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdg
    sitagnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkl
    lkkngltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilm
    tlvyelkrrggglgvaaicsgaaqgdavlvqvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lp7E (E:)
    ktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqagsg
    qipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsnip
    yavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalrs
    haraakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasgsit
    agnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaaainkllkkngl
    tvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilmtlvyel
    rrggglgvaaicsgaaqgdavlvqvh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5lp7F (F:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdg
    sitagnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkl
    lkkngltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilm
    tlvyelkrrggglgvaaicsgaaqgdavlvqvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lp7F (F:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkcasglravtlcdqmiraqdadilvaggmesmsni
    pyavpagrwgamgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalrs
    haraakaadegkfqdeivpvnkpnvvdkdeairrdsldqlaklapiyasdgsitagnapg
    vndgagafvlmseekaaelgkrplatilgfsttgmpahepgfainkllkkngltvqdidl
    fevneafasvvltcekivgfdlekvnvnggaialghpigasgarilmtlvyelkrrgggl
    gvaaicsgaaqgdavlvqvh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5lp7G (G:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdg
    sitagnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkl
    lkkngltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilm
    tlvyelkrrggglgvaaicsgaaqgdavlvqvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lp7G (G:)
    rktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqags
    gqipsrqaarlagmpwsvpsetlnkcasglravtlcdqmiraqdadilvaggmesmsnip
    yavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalrs
    haraakaadegkfqdeivpvnwignvvdkdeairrdtsldqlaklapiyasdgsitagna
    pgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkllkknglt
    vqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilmtlvyelk
    rrggglgvaaicsgaagdavlvqvh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5lp7H (H:)
    mrktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqag
    sgqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsn
    ipyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewal
    rsharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdg
    sitagnapgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkl
    lkkngltvqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilm
    tlvyelkrrggglgvaaicsgaaqgdavlvqvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lp7H (H:)
    rktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqags
    gqipsrqaarlagmpwsvpsetlnkcasglravtlcdqmiraqdadilvaggmesmsnip
    yavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalrs
    haraakaadegkfqdeivpvnwignvvdkdeairrdtsldqlaklapiyasdgsitagna
    pgvndgagafvlmseekaaelgkrplatilgfsttgmpahelaaapgfainkllkknglt
    vqdidlfevneafasvvltcekivgfdlekvnvnggaialghpigasgarilmtlvyelk
    rrggglgvaaicsgaaqgdavlvqvh