PDB entry 5lnx

View 5lnx on RCSB PDB site
Description: Crystal structure of MmgC, an acyl-CoA dehydrogenase from bacillus subtilis.
Class: oxidoreductase
Keywords: dehydrogenase, oxidoreductase
Deposited on 2016-08-07, released 2017-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgC, yqiN, BSU24150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnxa1, d5lnxa2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgC, yqiN, BSU24150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnxb1, d5lnxb2
  • Chain 'C':
    Compound: acyl-CoA dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgC, yqiN, BSU24150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnxc1, d5lnxc2
  • Chain 'D':
    Compound: acyl-CoA dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgC, yqiN, BSU24150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnxd1, d5lnxd2
  • Chain 'E':
    Compound: acyl-CoA dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgC, yqiN, BSU24150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnxe1, d5lnxe2
  • Chain 'F':
    Compound: acyl-CoA dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgC, yqiN, BSU24150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnxf1, d5lnxf2
  • Chain 'G':
    Compound: acyl-CoA dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgC, yqiN, BSU24150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnxg1, d5lnxg2
  • Chain 'H':
    Compound: acyl-CoA dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: mmgC, yqiN, BSU24150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnxh1, d5lnxh2
  • Heterogens: GOL, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lnxA (A:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvg
    rigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyha
    adlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdypverllrdakvtqiy
    egtneiqrliiskyllggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnxA (A:)
    eqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggagadvv
    syilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlgafalte
    phsgsdagslrttaikkgkyllngskifitnggaadiyitfaltapdqgrhgisafivek
    ntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvgrigiaa
    qalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyhaadlhng
    lncgkeasmakqfasdaavkalvqiyggygymkdypverllrdakvtqiyegtneiqrli
    iskyllg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lnxB (B:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvg
    rigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyha
    adlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdypverllrdakvtqiy
    egtneiqrliiskyllggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnxB (B:)
    qeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmipvpeqyggagadvv
    syilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlgafalte
    phsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisafive
    kntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvgrigia
    aqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyhaadlhn
    rglncgkeasmakqfasdaavkaldavqiyggygymkdypverllrdakvtqiyegtnei
    qrliiskyllgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lnxC (C:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvg
    rigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyha
    adlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdypverllrdakvtqiy
    egtneiqrliiskyllggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnxC (C:)
    vmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggagadvvsy
    ilaiheisrisaavgvilsvhtsvgtnpilyfgeeqkmkyipnlasgdhlgafaltephs
    gsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisafiveknt
    pgftvgkkerklglygsnttelifdnaevpanllgkegdgfhiamanlnvgrigiaaqal
    giaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyhaadlhnrncg
    keasmakqfasdaavkaldvqiyggygymkdypverllrdakvtqiyegtneiqrliisk
    yllg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lnxD (D:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvg
    rigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyha
    adlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdypverllrdakvtqiy
    egtneiqrliiskyllggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnxD (D:)
    mhvqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggag
    advvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlgaf
    altephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisa
    fivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvgr
    igiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyhaa
    dlhnrlncgkeasmakqfasdaavkaldavqiyggygymkdypverllrdakvtqiyegt
    neiqrliiskyllg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5lnxE (E:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvg
    rigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyha
    adlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdypverllrdakvtqiy
    egtneiqrliiskyllggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnxE (E:)
    eqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggagadvv
    syilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlgaaltep
    hsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqghgisafivekn
    tpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvgrigiaaq
    algiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyhaadlhnrg
    lncgkeasmakqfasdaavaldavqiyggygymkdypverllrdakvtqiyegtneiqrl
    iiskyllg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5lnxF (F:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvg
    rigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyha
    adlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdypverllrdakvtqiy
    egtneiqrliiskyllggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnxF (F:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnevpeanlgkegdgfhimanlnvgrig
    iaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyhaadl
    hnrglncgkeasmakqfasdaavaldavqiyggygymkdypverllrdakvtqiyegtne
    iqrliiskyllg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5lnxG (G:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvg
    rigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyha
    adlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdypverllrdakvtqiy
    egtneiqrliiskyllggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnxG (G:)
    vmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggagadvvsy
    ilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlgafalteph
    sgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisafivekn
    tpgftvgkkerklglygsnttelifdnaevpeanllgkeggfhiamanlnvgrigiaaqa
    lgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyhaadlhnrln
    cgkeasmakqfasdaavkaldavqiyggygymkdypverllrdakvtqiyegtneiqrli
    iskyllg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5lnxH (H:)
    mhvtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqygga
    gadvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlga
    faltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgis
    afivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvg
    rigiaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyha
    adlhnrglncgkeasmakqfasdaavkaaldavqiyggygymkdypverllrdakvtqiy
    egtneiqrliiskyllggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnxH (H:)
    vtqeqvmmrkmvrdfarkeiapaaeimektdefpfqlikkmgkhglmgipvpeqyggaga
    dvvsyilaiheisrisaavgvilsvhtsvgtnpilyfgneeqkmkyipnlasgdhlgafa
    ltephsgsdagslrttaikkngkyllngskifitnggaadiyitfaltapdqgrhgisaf
    ivekntpgftvgkkerklglygsnttelifdnaevpeanllgkegdgfhiamanlnvgri
    giaaqalgiaeaalehavdyakqrvqfgrpiaanqgisfkladmatraeaarhlvyhaad
    lhnrglncgkeasmakqfasdaavkaldavqiyggygymkdypverllrdakvtqiyegt
    neiqrliiskyllg