PDB entry 5lnw

View 5lnw on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana Pdx1-I320-G3P complex
Class: lyase
Keywords: beta/alpha barrel, pyridoxal phosphate synthase, glutamine amidotransferase, vitamin B6 biosythesis, lyase
Deposited on 2016-08-06, released 2017-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnwa_
  • Chain 'B':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnwb_
  • Chain 'C':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnwc_
  • Chain 'D':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lnwd_
  • Heterogens: K8P, RP5, HG3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lnwA (A:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmakarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrseehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnwA (A:)
    spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
    qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
    fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
    fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
    arraraivqavthysdpemlvevscglgeamvgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lnwB (B:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmakarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrseehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnwB (B:)
    kspfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsd
    pqmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfri
    pfvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevf
    tfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgd
    parraraivqavthysdpemlvevscglgeam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lnwC (C:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmakarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrseehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnwC (C:)
    spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
    qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
    fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
    fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifparra
    raivqavthysdpemlvevscglgea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lnwD (D:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmakarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrseehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lnwD (D:)
    pfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdpq
    mikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfripf
    vcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevftf
    akklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifparrar
    aivqavthysdpemlvevscgl