PDB entry 5lmw

View 5lmw on RCSB PDB site
Description: Llama nanobody PorM_02
Class: immune system
Keywords: NANOBODY, PORPHYROMONAS GINGIVALIS, TYPE 9 SECRETION SYSTEM, immune system
Deposited on 2016-08-01, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LMW
    Domains in SCOPe 2.07: d5lmwa1, d5lmwa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lmwA (A:)
    maqvqlvesggglvqagdslrlscaasgltfnrynmgwfrqapgrerefvasiswsgdrt
    ygtdsvkgrfaisrdnakntmylqmnslkpedtavyycaadrfltrsvkydywgqgtqvt
    vsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmwA (A:)
    vqlvesggglvqagdslrlscaasgltfnrynmgwfrqapgrerefvasiswsgdrtygt
    dsvkgrfaisrdnakntmylqmnslkpedtavyycaadrfltrsvkydywgqgtqvtvss