PDB entry 5lmj

View 5lmj on RCSB PDB site
Description: Llama nanobody PorM_19
Class: immune system
Keywords: nanobody, Porphyromonas gingivalis, Type-9 Secretion System (T9SS), immune system
Deposited on 2016-08-01, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LMJ
    Domains in SCOPe 2.07: d5lmja1, d5lmja2
  • Chain 'B':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LMJ
    Domains in SCOPe 2.07: d5lmjb1, d5lmjb2
  • Chain 'C':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LMJ
    Domains in SCOPe 2.07: d5lmjc1, d5lmjc2
  • Chain 'D':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LMJ
    Domains in SCOPe 2.07: d5lmjd1, d5lmjd2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lmjA (A:)
    maqvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggst
    wyhdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmjA (A:)
    qvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggstwy
    hdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtqvt
    vss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lmjB (B:)
    maqvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggst
    wyhdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmjB (B:)
    qvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggstwy
    hdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtqvt
    vss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lmjC (C:)
    maqvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggst
    wyhdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmjC (C:)
    qvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggstwy
    hdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtqvt
    vss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lmjD (D:)
    maqvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggst
    wyhdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmjD (D:)
    qvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggstwy
    hdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtqvt
    vss