PDB entry 5lmb

View 5lmb on RCSB PDB site
Description: human spleen tyrosine kinase kinase domain in complex with azanaphthyridine inhibitor
Class: transferase
Keywords: Inhibitor, Complex, Kinase, transferase
Deposited on 2016-07-29, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lmba_
  • Chain 'B':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lmbb_
  • Heterogens: 6ZF, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lmbA (A:)
    gpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdell
    aeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqv
    smgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkw
    yapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcp
    remydlmnlcwtydvenrpgfaavelrlrnyyydvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmbA (A:)
    yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilpalkdellaeanvmqqldn
    pyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesn
    fvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykf
    ssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcw
    tydvenrpgfaavelrlrnyyydvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lmbB (B:)
    gpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdell
    aeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqv
    smgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkw
    yapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcp
    remydlmnlcwtydvenrpgfaavelrlrnyyydvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lmbB (B:)
    yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanv
    mqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmk
    yleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykawpvkwyapecinyyk
    fssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlc
    wtydvenrpgfaavelrlrnyy