PDB entry 5llv

View 5llv on RCSB PDB site
Description: Crystal structure of DACM F87M/L110M Transthyretin mutant
Class: transport protein
Keywords: Tetramer, Protein aggregation, N-(7-Dimethylamino-4-Methylcoumarin-3-yl))Maleimide, transport protein
Deposited on 2016-07-28, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (87)
      • engineered mutation (110)
    Domains in SCOPe 2.07: d5llva_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (87)
      • engineered mutation (110)
    Domains in SCOPe 2.07: d5llvb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (87)
      • engineered mutation (110)
    Domains in SCOPe 2.07: d5llvc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (87)
      • engineered mutation (110)
    Domains in SCOPe 2.07: d5llvd_
  • Heterogens: CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5llvA (A:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5llvA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5llvB (B:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5llvB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5llvC (C:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5llvC (C:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5llvD (D:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5llvD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp