PDB entry 5lj9

View 5lj9 on RCSB PDB site
Description: Structure of the E. coli MacB ABC domain (C2221)
Class: transport protein
Keywords: Membrane Protein, ABC Transporter, transport protein
Deposited on 2016-07-18, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrolide export ATP-binding/permease protein macB
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: macB, ybjZ, b0879, JW0863
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75831 (0-222)
      • expression tag (223-228)
    Domains in SCOPe 2.07: d5lj9a1, d5lj9a2
  • Chain 'B':
    Compound: Macrolide export ATP-binding/permease protein macB
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: macB, ybjZ, b0879, JW0863
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75831 (Start-222)
      • expression tag (223-228)
    Domains in SCOPe 2.07: d5lj9b1, d5lj9b2
  • Chain 'C':
    Compound: Macrolide export ATP-binding/permease protein macB
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: macB, ybjZ, b0879, JW0863
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75831 (Start-222)
      • expression tag (223-228)
    Domains in SCOPe 2.07: d5lj9c1, d5lj9c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lj9A (A:)
    mtpllelkdirrsypagdeqvevlkgisldiyagemvaivgasgsgkstlmnilgcldka
    tsgtyrvagqdvatldadalaqlrrehfgfifqryhllshltaeqnvevpavyaglerkq
    rllraqellqrlgledrteyypaqlsggqqqrvsiaralmnggqviladeptgaldshsg
    eevmailhqlrdrghtviivthdpqvaaqaervieirdgeivrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lj9A (A:)
    mtpllelkdirrsypagdeqvevlkgisldiyagemvaivgasgsgkstlmnilgcldka
    tsgtyrvagqdvatldadalaqlrrehfgfifqryhllshltaeqnvevpavyaglerkq
    rllraqellqrlgledrteyypaqlsggqqqrvsiaralmnggqviladeptgaldshsg
    eevmailhqlrdrghtviivthdpqvaaqaervieirdgeivrlehhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lj9B (B:)
    mtpllelkdirrsypagdeqvevlkgisldiyagemvaivgasgsgkstlmnilgcldka
    tsgtyrvagqdvatldadalaqlrrehfgfifqryhllshltaeqnvevpavyaglerkq
    rllraqellqrlgledrteyypaqlsggqqqrvsiaralmnggqviladeptgaldshsg
    eevmailhqlrdrghtviivthdpqvaaqaervieirdgeivrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lj9B (B:)
    tpllelkdirrsypagdeqvevlkgisldiyagemvaivgasgsgkstlmnilgcldkat
    sgtyrvagqdvatldadalaqlrrehfgfifqryhllshltaeqnvevpavyaglerkqr
    llraqellqrlgledrteyypaqlsggqqqrvsiaralmnggqviladeptgaldshsge
    evmailhqlrdrghtviivthdpqvaaqaervieirdgeivrlehhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lj9C (C:)
    mtpllelkdirrsypagdeqvevlkgisldiyagemvaivgasgsgkstlmnilgcldka
    tsgtyrvagqdvatldadalaqlrrehfgfifqryhllshltaeqnvevpavyaglerkq
    rllraqellqrlgledrteyypaqlsggqqqrvsiaralmnggqviladeptgaldshsg
    eevmailhqlrdrghtviivthdpqvaaqaervieirdgeivrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lj9C (C:)
    tpllelkdirrsypagdeqvevlkgisldiyagemvaivgasgsgkstlmnilgcldkat
    sgtyrvagqdvatldadalaqlrrehfgfifqryhllshltaeqnvevpavyaglerkqr
    llraqellqrlgledrteyypaqlsggqqqrvsiaralmnggqviladeptgaldshsge
    evmailhqlrdrghtviivthdpqvaaqaervieirdgeivrlehhhh