PDB entry 5liy

View 5liy on RCSB PDB site
Description: Crystal structure of human AKR1B10 complexed with NADP+ and the inhibitor MK204
Class: oxidoreductase
Keywords: alpha-beta TIM barrel, cytosol, aldo-keto reductase, halogenated ligand, oxidoreductase
Deposited on 2016-07-15, released 2016-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Aldo-keto reductase family 1 member B10
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B10, AKR1B11
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60218 (0-315)
      • engineered mutation (124)
      • engineered mutation (300)
    Domains in SCOPe 2.08: d5liyx_
  • Heterogens: NAP, DQP, EDO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5liyX (X:)
    matfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiq
    ekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgd
    dlfprddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykp
    vtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaak
    hkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracn
    llqsshledypfnaey