PDB entry 5lhu

View 5lhu on RCSB PDB site
Description: ATP Phosphoribosyltransferase from Mycobacterium tuberculosis in complex with the allosteric inhibitor L-Histidine
Class: transferase
Keywords: ATP-PRTase, ACT, His G, Histidine biosynthesis, Transferase
Deposited on 2016-07-12, released 2017-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: hisG, Rv2121c, MTCY261.17c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lhua1, d5lhua2
  • Heterogens: HIS, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lhuA (A:)
    mahhhhhhaamlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrp
    kdiaiyvgsgeldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagm
    riataypnlvrkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvaf
    geplcdseavlieragtdgqdqteardqlvarvqgvvfgqqylmldydcprsalkkatai
    tpglesptiapladpdwvairalvprrdvngimdelaaigakailasdirfcrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lhuA (A:)
    mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg
    eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv
    rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav
    lieragtdgqdqteardqlvarvqgvvfgqqylmldydcprsalkkataitpglesptia
    pladpdwvairalvprrdvngimdelaaigakailasdirfcrf