PDB entry 5lgj

View 5lgj on RCSB PDB site
Description: the crystal structure of ige fc mutant - p333c
Class: immune system
Keywords: immune system, immunoglobulin domain, glycoprotein
Deposited on 2016-07-07, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (0-318)
      • conflict (38)
      • engineered mutation (106)
      • conflict (144)
    Domains in SCOPe 2.07: d5lgja1, d5lgja2, d5lgja3
  • Chain 'B':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (Start-319)
      • conflict (38)
      • conflict (144)
    Domains in SCOPe 2.07: d5lgjb1, d5lgjb2, d5lgjb3
  • Heterogens: NAG, BMA, MAN, SO4, PG4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lgjA (A:)
    dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
    egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsncrgvsaylsrpspf
    dlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvg
    trdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacli
    qnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficra
    vheaaspsqtvqravsvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lgjA (A:)
    dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
    egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcacrgsaylsrpspfdlfi
    rksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvgtrdw
    iegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacliqnfm
    pedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficravhea
    aspsqtvqravsvnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lgjB (B:)
    dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
    egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsncrgvsaylsrpspf
    dlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvg
    trdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacli
    qnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficra
    vheaaspsqtvqravsvnpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lgjB (B:)
    pptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttlast
    qseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnvsaylsrpspfdlfirkspti
    tclvvdlapkgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvgtrdwiegetyq
    crvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacliqnfmpedisvq
    wlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficravheaaspsqtv
    qravsvnpg