PDB entry 5ld8

View 5ld8 on RCSB PDB site
Description: GSK3011724A cocrystallised with Mycobacterium tuberculosis H37Rv KasA
Class: transferase
Keywords: inhibitor, complex, kasa, mycobacterium tuberculosis, transferase
Deposited on 2016-06-23, released 2016-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: kasA, Rv2245, MTCY427.26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ld8a1, d5ld8a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: kasA, Rv2245, MTCY427.26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ld8b1, d5ld8b2
  • Heterogens: NA, 6U5, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ld8A (A:)
    mgsshhhhhhssglvprgshsqpstanggfpsvvvtavtattsispdiestwkgllages
    gihaledefvtkwdlavkigghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagsp
    evdpdrfavvvgtglggaerivesydlmnaggprkvsplavqmimpngaaaviglqlgar
    agvmtpvsacssgseaiahawrqivmgdadvavcggvegpiealpiaafsmmramstrnd
    eperasrpfdkdrdgfvfgeagalmlieteehakargakplarllgagitsdafhmvapa
    adgvragramtrslelaglspadidhvnahgtatpigdaaeanairvagcdqaavyapks
    alghsigavgalesvltvltlrdgvipptlnyetpdpeidldvvageprygdyryavnns
    fgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ld8A (A:)
    pstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkiggh
    lkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaeriv
    esydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsacssgseaiahawr
    qivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfgeag
    almlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelaglspa
    didhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvltlr
    dgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ld8B (B:)
    mgsshhhhhhssglvprgshsqpstanggfpsvvvtavtattsispdiestwkgllages
    gihaledefvtkwdlavkigghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagsp
    evdpdrfavvvgtglggaerivesydlmnaggprkvsplavqmimpngaaaviglqlgar
    agvmtpvsacssgseaiahawrqivmgdadvavcggvegpiealpiaafsmmramstrnd
    eperasrpfdkdrdgfvfgeagalmlieteehakargakplarllgagitsdafhmvapa
    adgvragramtrslelaglspadidhvnahgtatpigdaaeanairvagcdqaavyapks
    alghsigavgalesvltvltlrdgvipptlnyetpdpeidldvvageprygdyryavnns
    fgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ld8B (B:)
    pstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkiggh
    lkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaeriv
    esydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsacssgseaiahawr
    qivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfgeag
    almlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelaglspa
    didhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvltlr
    dgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry