PDB entry 5lbv

View 5lbv on RCSB PDB site
Description: Structural basis of zika and dengue virus potent antibody cross-neutralization
Class: viral protein
Keywords: Immune system-viral protein complex, zika virus, broadly neutralizing antibody, viral protein
Deposited on 2016-06-17, released 2016-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lbva1, d5lbva2
  • Chain 'B':
    Compound: Envelope protein E
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lbvb1, d5lbvb2
  • Heterogens: NAG, BMA, FUC, MAN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lbvA (A:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
    ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
    alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
    kgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlit
    anpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstiggpfeddddkagw
    shpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbvA (A:)
    ircigvsnrdfveggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsycyea
    sisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfacsk
    kmtgksiqpenleyrimlsvhgsqhsgmidtghetdenrakveitpnspraeatlggfgs
    lgldceprtgdlyyltmnnkhwlvhkewfhdiplpwhagtphwnnkealvefkdahakrq
    tvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsyslctaaft
    ftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestensk
    mmleldppfgdsyivigvgekkithhwhrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lbvB (B:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
    ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
    alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
    kgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlit
    anpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstiggpfeddddkagw
    shpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbvB (B:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
    ggfgslgldcepfsdlyyltmnnkhwlvhkewfhdiplpwhagaphwnnkealvefkdah
    akrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsyslct
    aaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitest
    enskmmleldppfgdsyivigvgekkithhwhrs