PDB entry 5lbs

View 5lbs on RCSB PDB site
Description: structural basis of Zika and Dengue virus potent antibody cross-neutralization
Class: immune system-viral protein
Keywords: immune system-viral protein complex, zika virus, broadly neutralizing antibody, immune system-viral protein
Deposited on 2016-06-17, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Zika virus [TaxId:64320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A120IIH9 (0-End)
      • expression tag (436-445)
  • Chain 'B':
    Compound: Envelope protein E
    Species: Zika virus [TaxId:64320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A120IIH9 (0-End)
      • expression tag (436-442)
  • Chain 'H':
    Compound: broadly neutralizing human antibody ede1 c8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBS (0-End)
    Domains in SCOPe 2.07: d5lbsh_
  • Chain 'I':
    Compound: broadly neutralizing human antibody ede1 c8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBS (0-End)
    Domains in SCOPe 2.07: d5lbsi_
  • Chain 'L':
    Compound: broadly neutralizing human antibody ede1 c8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBS
    Domains in SCOPe 2.07: d5lbsl_
  • Chain 'M':
    Compound: broadly neutralizing human antibody ede1 c8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBS (0-End)
    Domains in SCOPe 2.07: d5lbsm_
  • Heterogens: EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5lbsH (H:)
    evqlvesggglvqpggslrlscsasgftfstysmhwvrqapgkgleyvsaitgegdsafy
    adsvkgrftisrdnskntlyfemnslrpedtavyycvggysnfyyyytmdvwgqgttvtv
    ssgtggsggggsggggsggga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbsH (H:)
    evqlvesggglvqpggslrlscsasgftfstysmhwvrqapgkgleyvsaitgegdsafy
    adsvkgrftisrdnskntlyfemnslrpedtavyycvggysnfyyyytmdvwgqgttvtv
    s
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5lbsI (I:)
    evqlvesggglvqpggslrlscsasgftfstysmhwvrqapgkgleyvsaitgegdsafy
    adsvkgrftisrdnskntlyfemnslrpedtavyycvggysnfyyyytmdvwgqgttvtv
    ssgtggsggggsggggsggga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbsI (I:)
    evqlvesggglvqpggslrlscsasgftfstysmhwvrqapgkgleyvsaitgegdsafy
    adsvkgrftisrdnskntlyfemnslrpedtavyycvggysnfyyyytmdvwgqgttvtv
    ss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5lbsL (L:)
    seivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgvp
    arfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkveikaaaddddkagw
    shpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbsL (L:)
    eivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgvpa
    rfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkveikaaa
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5lbsM (M:)
    seivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgvp
    arfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkveikaaaddddkagw
    shpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbsM (M:)
    seivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgvp
    arfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkveikaaa