PDB entry 5la3

View 5la3 on RCSB PDB site
Description: [FeFe]-hydrogenase CpI from Clostridium pasteurianum, variant E279A
Class: oxidoreductase
Keywords: Hydrogenase, H-cluster, OXIDOREDUCTASE, semisynthetic enzyme
Deposited on 2016-06-13, released 2017-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29166 (0-572)
      • engineered mutation (277)
      • expression tag (573)
    Domains in SCOPe 2.06: d5la3a1, d5la3a2, d5la3a3, d5la3a4
  • Chain 'B':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29166 (Start-572)
      • engineered mutation (277)
      • expression tag (573-575)
    Domains in SCOPe 2.06: d5la3b1, d5la3b2, d5la3b3, d5la3b4
  • Heterogens: 402, SF4, FES, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5la3A (A:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeaatelvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfkykksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5la3A (A:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeaatelvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfkykks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5la3B (B:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeaatelvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfkykksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5la3B (B:)
    tiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvtac
    dtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykarask
    pflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaede
    kcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelfn
    mgfgvdvtgkiytalrqlgfdkifdinfgadmtimeaatelvqrienngpfpmftsccpg
    wvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfea
    drpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatgg
    vmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfmk
    sgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrks
    hentalvkmyqnyfgkpgegraheilhfkykksaw