PDB entry 5l8f

View 5l8f on RCSB PDB site
Description: Crystal structure of Rhodospirillum rubrum Rru_A0973 mutant E32A, E62A, H65A.
Class: oxidoreductase
Keywords: ferritin, iron oxidation, ferroxidase, oxidoreductase
Deposited on 2016-06-07, released 2017-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5l8fa_
  • Chain 'B':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.06: d5l8fb1, d5l8fb2
  • Chain 'C':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5l8fc_
  • Chain 'D':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5l8fd_
  • Chain 'E':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5l8fe_
  • Chain 'F':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5l8ff_
  • Chain 'G':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.06: d5l8fg1, d5l8fg2
  • Chain 'H':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5l8fh_
  • Chain 'I':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
      • expression tag (96)
    Domains in SCOPe 2.06: d5l8fi1, d5l8fi2
  • Chain 'J':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:269796]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • engineered mutation (31)
      • engineered mutation (61)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5l8fj_
  • Heterogens: MG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l8fA (A:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fA (A:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l8fB (B:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fB (B:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5l8fC (C:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fC (C:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5l8fD (D:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fD (D:)
    theplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaaa
    mtlewlrrndakwaehlrtylftegpit
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5l8fE (E:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fE (E:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5l8fF (F:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fF (F:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5l8fG (G:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fG (G:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5l8fH (H:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fH (H:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5l8fI (I:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fI (I:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5l8fJ (J:)
    maqssnstheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrd
    eakeaaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8fJ (J:)
    stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
    amtlewlrrndakwaehlrtylftegpita