PDB entry 5l86

View 5l86 on RCSB PDB site
Description: engineered ascorbate peroxidise
Class: oxidoreductase
Keywords: protein engineering, peroxidase, heme, apx2, methyl histidine, oxidoreductase
Deposited on 2016-06-07, released 2017-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ascorbate peroxidase
    Species: Glycine max [TaxId:3847]
    Gene: apx1, GLYMA_U021900
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43758 (0-246)
      • engineered mutation (11)
      • engineered mutation (38)
      • engineered mutation (109)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d5l86a_
  • Chain 'B':
    Compound: ascorbate peroxidase
    Species: Glycine max [TaxId:3847]
    Gene: apx1, GLYMA_U021900
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43758 (0-246)
      • engineered mutation (11)
      • engineered mutation (38)
      • engineered mutation (109)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d5l86b_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l86A (A:)
    ksyptvsadyqdavekakkklrgfiaekrcaplmlrlafhsagtfdkgtktggpfgtikh
    paelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpkvpfhpgredk
    pepppegrlpdptkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwtsn
    plifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqkl
    selgfad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l86B (B:)
    ksyptvsadyqdavekakkklrgfiaekrcaplmlrlafhsagtfdkgtktggpfgtikh
    paelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpkvpfhpgredk
    pepppegrlpdptkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwtsn
    plifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqkl
    selgfad