PDB entry 5l7p

View 5l7p on RCSB PDB site
Description: In silico-powered specific incorporation of photocaged Dopa at multiple protein sites
Class: ligase
Keywords: TyrRS, ligase
Deposited on 2016-06-03, released 2017-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (Start-317)
      • engineered mutation (43)
      • engineered mutation (76)
      • engineered mutation (81)
      • engineered mutation (120)
      • engineered mutation (169-170)
      • engineered mutation (173)
      • engineered mutation (178)
      • engineered mutation (191)
      • engineered mutation (297)
    Domains in SCOPe 2.07: d5l7pa_
  • Chain 'B':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (12-317)
      • engineered mutation (43)
      • engineered mutation (76)
      • engineered mutation (81)
      • engineered mutation (120)
      • engineered mutation (169-170)
      • engineered mutation (173)
      • engineered mutation (178)
      • engineered mutation (191)
      • engineered mutation (297)
    Domains in SCOPe 2.07: d5l7pb_
  • Heterogens: 1PE, CA, CL, BUU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l7pA (A:)
    mrgshhhhhhgsmdefemikrntseiiseeelrevlkkdeksaaigfepsgkihlghylq
    ikkmidlqnagfdiiiiladlaaylnqkgeldeirkigdynkkvfeamglkakyvygsef
    aldkdytlnvyrlalkttlkrarrsmeliaredenpkvaeviypimqvnaahymgvdvnv
    ggmeqrkihmlqrellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikk
    aycpagvvegnpimeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlk
    navaeelikilepirkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l7pA (A:)
    defemikrntseiiseeelrevlkkdeksaaigfepsgkihlghylqikkmidlqnagfd
    iiiiladlaaylnqkgeldeirkigdynkkvfeamglkakyvygsefaldkdytlnvyrl
    alkttlkrarrsmelianpkvaeviypimqvnaahymgvdvnvggmeqrkihmlqrellp
    kkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpimeia
    kyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikilepirkr
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l7pB (B:)
    mrgshhhhhhgsmdefemikrntseiiseeelrevlkkdeksaaigfepsgkihlghylq
    ikkmidlqnagfdiiiiladlaaylnqkgeldeirkigdynkkvfeamglkakyvygsef
    aldkdytlnvyrlalkttlkrarrsmeliaredenpkvaeviypimqvnaahymgvdvnv
    ggmeqrkihmlqrellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikk
    aycpagvvegnpimeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlk
    navaeelikilepirkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l7pB (B:)
    mdefemikrntseiiseeelrevlkkdeksaaigfepsgkihlghylqikkmidlqnagf
    diiiiladlaaylnqkgeldeirkigdynkkvfeamglkakyvygsefaldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnaahymgvdvnvggmeqrkihmlq
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
    pirkrl