PDB entry 5l7f

View 5l7f on RCSB PDB site
Description: Crystal structure of MMP12 mutant K421A in complex with RXP470.1 conjugated with fluorophore Cy5,5 in space group P21.
Class: hydrolase
Keywords: Probes for optical imaging, MMP-12, metalloprotease, inflammation, aneurysm, fluorophore, Cy5, 5, cyanine, hydrolase
Deposited on 2016-06-03, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered mutation (66)
      • engineered mutation (136)
    Domains in SCOPe 2.07: d5l7fa_
  • Chain 'B':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered mutation (66)
      • engineered mutation (136)
    Domains in SCOPe 2.07: d5l7fb_
  • Heterogens: ZN, CA, 6PJ, BR, EDO, R47, GOL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l7fA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l7fA (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l7fB (B:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptyayvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l7fB (B:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptyayvdintfrlsaddirgiqslyg