PDB entry 5l7e

View 5l7e on RCSB PDB site
Description: MCR IN COMPLEX WITH ligand
Class: signaling protein
Keywords: MINERALOCORTICOID RECEPTOR 2, signaling protein
Deposited on 2016-06-03, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235 (Start-271)
      • conflict (95)
      • conflict (97)
      • conflict (197)
    Domains in SCOPe 2.06: d5l7ea_
  • Chain 'B':
    Compound: NCOA1 peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L7E (0-9)
  • Heterogens: NHE, MPD, SO4, EDO, 6Q0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l7eA (A:)
    mhnhnhnhnhnhnggenlyfqgtpspvmvleniepeivyagydsskpdtaenllstlnrl
    agkqmiqvvkwakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapd
    lvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaaf
    eemrtnyikelrkmvtkspnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshal
    kvefpamlveiisdqlpkvesgnakplyfhrkggslvprgsgggsggsggpqaqqksllq
    qllte
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l7eA (A:)
    spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
    dqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
    lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtksqswqrf
    yqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyf
    hrk
    

  • Chain 'B':
    No sequence available.