PDB entry 5l79

View 5l79 on RCSB PDB site
Description: Crystal structure of MMP12 in complex with RXP470.1 conjugated with fluorophore Cy5,5 in space group P21212.
Class: hydrolase
Keywords: Probes for optical imaging, MMP-12, metalloprotease, inflammation, aneurysm, fluorophore, Cy5, 5, cyanine, hydrolase
Deposited on 2016-06-02, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5l79a1, d5l79a2
  • Heterogens: ZN, CA, R47, 6PJ, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l79A (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg