PDB entry 5l6y

View 5l6y on RCSB PDB site
Description: il13 in complex with tralokinumab
Class: immune system
Keywords: IL13 antibody tralokinumab asthma, IL13, immune system
Deposited on 2016-06-01, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l6yc_
  • Chain 'H':
    Compound: tralokinumab FAb digest VH
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L6Y (Start-237)
  • Chain 'L':
    Compound: tralokiumab FAb digest VL
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5L6Y
    Domains in SCOPe 2.07: d5l6yl1, d5l6yl2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5l6yC (C:)
    gpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaie
    ktqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l6yC (C:)
    ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq
    rmlsgfcdtkievaqfvkdlllhlkklfregrfn
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5l6yL (L:)
    syvltqppsvsvapgktaritcggniigsklvhwyqqkpgqapvlviyddgdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdtgsdpvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l6yL (L:)
    yvltqppsvsvapgktaritcggniigsklvhwyqqkpgqapvlviyddgdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdtgsdpvvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec