PDB entry 5l6i

View 5l6i on RCSB PDB site
Description: Uba1 in complex with Ub-MLN4924 covalent adduct
Class: ligase
Keywords: E1 enzyme, ubiquitin activation, Uba1 inhibitor, adenosyl sulfamate, ligase
Deposited on 2016-05-30, released 2017-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: UBA1, YKL210W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-40S ribosomal protein S31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RPS31, RPS37, UBI3, YLR167W, L9470.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5l6ib_
  • Chain 'C':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: UBA1, YKL210W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-40S ribosomal protein S31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RPS31, RPS37, UBI3, YLR167W, L9470.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5l6id_
  • Chain 'E':
    Compound: Ubiquitin-40S ribosomal protein S31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RPS31, RPS37, UBI3, YLR167W, L9470.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5l6ie_
  • Heterogens: SO4, CL, GOL, B39, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l6iB (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l6iD (D:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5l6iE (E:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l6iE (E:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrg