PDB entry 5l6i

View 5l6i on RCSB PDB site
Description: Uba1 in complex with Ub-MLN4924 covalent adduct
Class: ligase
Keywords: E1 enzyme, ubiquitin activation, Uba1 inhibitor, adenosyl sulfamate, ligase
Deposited on 2016-05-30, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin-activating enzyme E1 1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: UBA1, YKL210W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22515 (Start-1023)
• Chain 'B':
  Compound: Ubiquitin-40S ribosomal protein S31
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: RPS31, RPS37, UBI3, YLR167W, L9470.14
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05759 (0-75)
  Domains in SCOPe 2.07: d5l6ib_
• Chain 'C':
  Compound: Ubiquitin-activating enzyme E1 1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: UBA1, YKL210W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22515 (Start-1023)
• Chain 'D':
  Compound: Ubiquitin-40S ribosomal protein S31
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: RPS31, RPS37, UBI3, YLR167W, L9470.14
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05759 (0-75)
  Domains in SCOPe 2.07: d5l6id_
• Chain 'E':
  Compound: Ubiquitin-40S ribosomal protein S31
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: RPS31, RPS37, UBI3, YLR167W, L9470.14
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05759 (0-75)
  Domains in SCOPe 2.07: d5l6ie_
• Heterogens: SO4, CL, GOL, B39, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5l6iB (B:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5l6iD (D:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg
  

  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >5l6iE (E:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5l6iE (E:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrg