PDB entry 5l36

View 5l36 on RCSB PDB site
Description: Crystal Structure of a human FasL mutant in complex with human DcR3
Class: apoptosis
Keywords: FasL, CD95L, DcR3, TNF ligand and receptor, decoy receptor, apoptosis
Deposited on 2016-08-03, released 2016-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FASLG, APT1LG1, CD95L, FASL, TNFSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48023 (Start-152)
      • conflict (35-37)
      • conflict (39-40)
    Domains in SCOPe 2.06: d5l36a_
  • Chain 'B':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF6B, DCR3, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l36A (A:)
    mqighpspppekkelrkvahltgksnsrsmplewehelglallsgvkykkgglvinetgl
    yfvyskvyfrgqscnnlplshkvymrnskypqdlvmmegkmmsycttgqmwarssylgav
    fnltsadhlyvnvselslvnfeesqtffglykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l36A (A:)
    lrkvahltgkssrsmplewehelglallsgvkykkgglvinetglyfvyskvyfrgqscn
    nlplshkvymrnskypqdlvmmegkmmsycttgqmwarssylgavfnltsadhlyvnvse
    lslvnfeesqtffglykl
    

  • Chain 'B':
    No sequence available.