PDB entry 5l2p

View 5l2p on RCSB PDB site
Description: Structure of arylesterase
Class: hydrolase
Keywords: arylesterase, HYDROLASE
Deposited on 2016-08-02, released 2017-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arylesterase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: are
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5l2pa_
  • Chain 'B':
    Compound: Arylesterase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: are
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5l2pb_
  • Chain 'C':
    Compound: Arylesterase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: are
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5l2pc_
  • Chain 'D':
    Compound: Arylesterase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: are
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5l2pd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l2pA (A:)
    mpldpevrnflqvyykaniidftkyqfqeirqkvnellakavpkdpvgetrdmkikledy
    elpiriyspikrtnnglvmhfhggawilgsietedaisrilsnscectvisvdyrlapey
    kfptavydcfnaivwardnagelgidkdkiatfgisaggnlvaatsllardnklkltaqv
    pvvpfvyldlasksmnryrkgyfldinlpvdygvkmyirdekdlynplfspliaedlsnl
    pqaivvtaeydplrdqgeayayrlmesgvptlsfrvngnvhaflgsprtsrqvtvmigal
    lkdifk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l2pB (B:)
    mpldpevrnflqvyykaniidftkyqfqeirqkvnellakavpkdpvgetrdmkikledy
    elpiriyspikrtnnglvmhfhggawilgsietedaisrilsnscectvisvdyrlapey
    kfptavydcfnaivwardnagelgidkdkiatfgisaggnlvaatsllardnklkltaqv
    pvvpfvyldlasksmnryrkgyfldinlpvdygvkmyirdekdlynplfspliaedlsnl
    pqaivvtaeydplrdqgeayayrlmesgvptlsfrvngnvhaflgsprtsrqvtvmigal
    lkdifk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l2pB (B:)
    mpldpevrnflqvyykaniidftkyqfqeirqkvnellakavpkdpvgetrdmkikledy
    elpiriyspikrtnnglvmhfhggawilgsietedaisrilsnscectvisvdyrlapey
    kfptavydcfnaivwardnagelgidkdkiatfgisaggnlvaatsllardnklkltaqv
    pvvpfvyldlasksmnryrkgyfldinlpvdygvkmyirdekdlynplfspliaedlsnl
    pqaivvtaeydplrdqgeayayrlmesgvptlsfrvngnvhaflgsprtsrqvtvmigal
    lkdif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5l2pC (C:)
    mpldpevrnflqvyykaniidftkyqfqeirqkvnellakavpkdpvgetrdmkikledy
    elpiriyspikrtnnglvmhfhggawilgsietedaisrilsnscectvisvdyrlapey
    kfptavydcfnaivwardnagelgidkdkiatfgisaggnlvaatsllardnklkltaqv
    pvvpfvyldlasksmnryrkgyfldinlpvdygvkmyirdekdlynplfspliaedlsnl
    pqaivvtaeydplrdqgeayayrlmesgvptlsfrvngnvhaflgsprtsrqvtvmigal
    lkdifk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l2pC (C:)
    mpldpevrnflqvyykaniyqfqeirqkvnellakavpkdpvgetrdmkikledyelpir
    iyspikrtnnglvmhfhggawilgsietedaisrilsnscectvisvdyrlapeykfpta
    vydcfnaivwardnagelgidkdkiatfgisaggnlvaatsllardnklkltaqvpvvpf
    vyldlasksmnryrkgyfldinlpvdygvkmyirdekdlynplfspliaedlsnlpqaiv
    vtaeydplrdqgeayayrlmesgvptlsfrvngnvhaflgsprtsrqvtvmigallkdif
    k
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5l2pD (D:)
    mpldpevrnflqvyykaniidftkyqfqeirqkvnellakavpkdpvgetrdmkikledy
    elpiriyspikrtnnglvmhfhggawilgsietedaisrilsnscectvisvdyrlapey
    kfptavydcfnaivwardnagelgidkdkiatfgisaggnlvaatsllardnklkltaqv
    pvvpfvyldlasksmnryrkgyfldinlpvdygvkmyirdekdlynplfspliaedlsnl
    pqaivvtaeydplrdqgeayayrlmesgvptlsfrvngnvhaflgsprtsrqvtvmigal
    lkdifk