PDB entry 5l19

View 5l19 on RCSB PDB site
Description: Crystal Structure of a human FasL mutant
Class: apoptosis
Keywords: FasL, CD95L, TNF ligand, apoptosis
Deposited on 2016-07-28, released 2016-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FASLG, APT1LG1, CD95L, FASL, TNFSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48023 (Start-152)
      • conflict (35-37)
      • conflict (39-40)
    Domains in SCOPe 2.06: d5l19a_
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l19A (A:)
    mqighpspppekkelrkvahltgksnsrsmplewehelglallsgvkykkgglvinetgl
    yfvyskvyfrgqscnnlplshkvymrnskypqdlvmmegkmmsycttgqmwarssylgav
    fnltsadhlyvnvselslvnfeesqtffglykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l19A (A:)
    ghpspppekkelrkvahltgksnsrsmplewehelglallsgvkykkgglvinetglyfv
    yskvyfrgqscnnlplshkvymrnskypqdlvmmegkmmsycttgqmwarssylgavfnl
    tsadhlyvnvselslvnfeesqtffglykl