PDB entry 5kzm

View 5kzm on RCSB PDB site
Description: Crystal structure of Tryptophan synthase alpha-beta chain complex from Francisella tularensis
Class: lyase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Center for Structural Genomics of Infectious Diseases, CSGID, LYASE
Deposited on 2016-07-25, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: trpA, FTT_1772c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kzma_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: trpB, FTT_1773c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kzmb_
  • Heterogens: ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kzmA (A:)
    mtnryttlfanlekrnegafipfvtigdpnkalsfeiidtlvssgadalelgipfsdpla
    dgptiqeaniralesgitpkdcfdiltkirakyphipiglllyanlvyangienfyqkcl
    dagvdsiliadvpaheskefrdiakkvgiaqifiappdasestlkqiselgsgytyllsr
    vgvtgtetaanmpvedvltklreynapkpvlgfgiskpeqvqqaikagaagaisgsatvk
    iiqnnisnkqkmlneltyfvkemkaatln
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzmA (A:)
    mtnryttlfanlekrnegafipfvtigdpnkalsfeiidtlvssgadalelgipfsdpla
    dgptiqeaniralesgitpkdcfdiltkirakyphipiglllyanlvyangienfyqkcl
    dagvdsiliadvpaheskefrdiakkvgiaqifiappdasestlkqiselgsgytyllsr
    vgmpvedvltklreynapkpvlgfgiskpeqvqqaikagaagaisgsatvkiiqnnisnk
    qkmlneltyfvkemkaatln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kzmB (B:)
    msklnayfgeyggqfvpqilvpaldqleqefikaqadesfkqefkellqeyagrptaltk
    trnivkntrtklylkredllhggahktnqvlgqallakrmgkkeiiaetgagqhgvatal
    acalldlkcrvymgakdverqspnvfrmklmgaevipvhsgsatlkdacnealrdwsany
    skahyllgtaagphpfptivrefqrmigeetkqqmlakegrlpdaviacvgggsnaigmf
    adfideknvkligvepagkgietgehgaplkhgktgiffgmkaplmqnsdgqieesysis
    agldfpsvgpqhahllaigrakyasatddealdafkllckkegiipalesshalahalkl
    ayedpnkeqllvvnlsgrgdkdiftvhdilkekgei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzmB (B:)
    msklnayfgeyggqfvpqilvpaldqleqefikaqadesfkqefkellqeyagrptaltk
    trnivkntrtklylkredllhggahktnqvlgqallakrmgkkeiiaetgagqhgvatal
    acalldlkcrvymgakdverqspnvfrmklmgaevipvhsgsatlkdacnealrdwsany
    skahyllgtaagphpfptivrefqrmigeetkqqmlakegrlpdaviacvgggsnaigmf
    adfideknvkligvepagkgietgehgaplkhgktgiffgmkaplmqnsdgqieesysis
    agldfpsvgpqhahllaigrakyasatddealdafkllckkegiipalesshalahalkl
    ayedpnkeqllvvnlsgrgdkdiftvhdilkekge