PDB entry 5kzj

View 5kzj on RCSB PDB site
Description: Loop Deletion mutant of Paracoccus denitrificans AztC
Class: metal binding protein
Keywords: Zinc binding protein, periplasm, deletion mutant, METAL BINDING PROTEIN
Deposited on 2016-07-25, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic solute binding protein
    Species: Paracoccus denitrificans (strain Pd 1222) [TaxId:318586]
    Gene: Pden_1597
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kzja_
  • Chain 'B':
    Compound: Periplasmic solute binding protein
    Species: Paracoccus denitrificans (strain Pd 1222) [TaxId:318586]
    Gene: Pden_1597
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kzjb_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kzjA (A:)
    mkdwlfriatcsimtfsslaaaqaepldvvatfsiigdfaakvggdrirlnvlvgpdsdt
    hvyeprpadaialagadvvltnglefegfltrliaasgtdaavatltdgvetmeepgggg
    ahdphawqavpnakvyvqniaaafcaadaegcaayqanaaryigeldaldteiraaiaal
    pqdrrtvvvahnafryfeaaygvhflspqgvsteseaaaadvaglireirarnasaifae
    nisdtrlleqiareaglplagtlysdalsgpdgpasnyiammrhnagaiaaalaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzjA (A:)
    epldvvatfsiigdfaakvggdrirlnvlvgpdsdthvyeprpadaialagadvvltngl
    efegfltrliaasgtdaavatltdgvetmeepggggahdphawqavpnakvyvqniaaaf
    caadaegcaayqanaaryigeldaldteiraaiaalpqdrrtvvvahnafryfeaaygvh
    flspqgvsteseaaaadvaglireirarnasaifaenisdtrlleqiareaglplagtly
    sdalsgpdgpasnyiammrhnagaiaaalaar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kzjB (B:)
    mkdwlfriatcsimtfsslaaaqaepldvvatfsiigdfaakvggdrirlnvlvgpdsdt
    hvyeprpadaialagadvvltnglefegfltrliaasgtdaavatltdgvetmeepgggg
    ahdphawqavpnakvyvqniaaafcaadaegcaayqanaaryigeldaldteiraaiaal
    pqdrrtvvvahnafryfeaaygvhflspqgvsteseaaaadvaglireirarnasaifae
    nisdtrlleqiareaglplagtlysdalsgpdgpasnyiammrhnagaiaaalaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzjB (B:)
    epldvvatfsiigdfaakvggdrirlnvlvgpdsdthvyeprpadaialagadvvltngl
    efegfltrliaasgtdaavatltdgvetmeepggggahdphawqavpnakvyvqniaaaf
    caadaegcaayqanaaryigeldaldteiraaiaalpqdrrtvvvahnafryfeaaygvh
    flspqgvsteseaaaadvaglireirarnasaifaenisdtrlleqiareaglplagtly
    sdalsgpdgpasnyiammrhnagaiaaalaa