PDB entry 5kze

View 5kze on RCSB PDB site
Description: N-acetylneuraminate lyase from methicillin-resistant Staphylococcus aureus
Class: lyase
Keywords: TIM-barrel, N-acetylneuraminate lyase, LYASE
Deposited on 2016-07-25, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylneuraminate lyase
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: nanA, SAUSA300_0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kzea_
  • Chain 'B':
    Compound: n-acetylneuraminate lyase
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: nanA, SAUSA300_0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kzeb_
  • Chain 'C':
    Compound: n-acetylneuraminate lyase
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: nanA, SAUSA300_0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kzec_
  • Chain 'D':
    Compound: n-acetylneuraminate lyase
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: nanA, SAUSA300_0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kzed_
  • Chain 'E':
    Compound: n-acetylneuraminate lyase
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: nanA, SAUSA300_0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kzee_
  • Chain 'F':
    Compound: n-acetylneuraminate lyase
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: nanA, SAUSA300_0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kzef_
  • Chain 'G':
    Compound: n-acetylneuraminate lyase
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: nanA, SAUSA300_0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kzeg_
  • Chain 'H':
    Compound: n-acetylneuraminate lyase
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: nanA, SAUSA300_0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kzeh_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kzeA (A:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
    fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
    diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzeA (A:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
    pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
    iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kzeB (B:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
    fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
    diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzeB (B:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
    pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
    iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kzeC (C:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
    fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
    diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzeC (C:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
    pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
    iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kzeD (D:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
    fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
    diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzeD (D:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
    pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
    iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5kzeE (E:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
    fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
    diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzeE (E:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
    pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
    iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5kzeF (F:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
    fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
    diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzeF (F:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
    pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
    iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5kzeG (G:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
    fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
    diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzeG (G:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
    pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
    iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5kzeH (H:)
    mnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqk
    kqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeir
    dyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirka
    fpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsn
    diietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzeH (H:)
    nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
    qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
    yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
    pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
    iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl